PBX1 Rabbit Polyclonal Antibody

CAT#: TA329195

Rabbit Polyclonal anti-PBX1 antibody

Product Images

WB Suggested Anti-PBX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PBX1 antibody: synthetic peptide directed towards the N terminal of human PBX1. Synthetic peptide located within the following region: MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: PBX homeobox 1
• Database Link:
  NP_002576
  Entrez Gene 5087 Human
  UniProt ID P40424
• Background: PBX1 binds the sequence 5'-ATCAATCAA-3'. It acts as a transcriptional activator of PF4 in complex with MEIS1. It may be converted into a potent transcriptional activator by the (1;19) translocation. It also may have a role in steroidogenesis and, subsequently, sexual development and differentiation.
• Synonyms: DKFZp686B09108; MGC126627
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors