Rabbit Polyclonal Anti-MSTN Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mstn antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mstn. Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN |
Rabbit anti GDF-8 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-MSTN Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 354-366 amino acids of Human myostatin |
MSTN Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 267-375 of human MSTN (NP_005250.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China