Products

Jump to Filters
View as table Download
ABCA5 Rabbit Polyclonal Antibody
TA331848

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCA5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI