Products

Jump to Filters
View as table Download
Ataxin 3 (ATXN3) Rabbit Polyclonal Antibody
TA327022

USD 275.00

3 Weeks

ATXN3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATXN3
Ataxin 3 (ATXN3) (Center) Rabbit Polyclonal Antibody
AP50312PU-N

USD 512.00

2 Weeks

Ataxin 3 (ATXN3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 267~297 amino acids from the Center region of human ATXN3
Ataxin 3 (ATXN3) Rabbit Polyclonal Antibody
TA308320

USD 415.00

5 Days

Rabbit Polyclonal antibody to Ataxin 3 (ataxin 3)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 245 of Ataxin 3 (Uniprot ID#P54252)
Ataxin 3 (ATXN3) Rabbit Polyclonal Antibody
TA339685

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATXN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATXN3 antibody: synthetic peptide directed towards the N terminal of human ATXN3. Synthetic peptide located within the following region: SIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNAL
ATXN3 Rabbit Polyclonal Antibody
TA365498

USD 380.00

4 Weeks

ATXN3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ATXN3
ATXN3 Rabbit Polyclonal Antibody
TA369810

USD 380.00

4 Weeks

ATXN3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ATXN3
Ataxin 3 (ATXN3) Rabbit Polyclonal Antibody
TA373861

USD 275.00

3 Weeks

Ataxin 3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human Ataxin 3 (NP_004984.2).
Modifications Unmodified