Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
Rabbit polyclonal CDC2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC2. |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP |
Rabbit Polyclonal CDC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC2 |
Rabbit Polyclonal CDC2 (Tyr15) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC2 around the phosphorylation site of Tyrosine 15 |
Modifications | Phospho-specific |
Rabbit polyclonal CDC2 (Ab-161) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of Threonine161. |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit Polyclonal Antibody against CDC2 (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human CDC2. |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the N terminal of human CDC2. Synthetic peptide located within the following region: EDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIRE |
CDK1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Antibody against CDC2 (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-241 amino acids from the C-terminal region of human CDC2. |
Rabbit Anti-cdc2 (Tyr15) Antibody (Phospho-Specific)
Applications | WB |
Reactivities | Human, Xenopus |
Conjugation | Unconjugated |
Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Tyr15 conjugated to KLH |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: KLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGT |
Phospho-CDK1-Y15 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y15 of human CDK1 |
Modifications | Phospho-specific |
Anti-CDK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1 |
CDK1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDK1 |
CDK1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-297 of human CDK1 (NP_001777.1). |
Modifications | Unmodified |
CDK1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 208-258 of human CDK1 (NP_001777.1). |
Modifications | Unmodified |
CDK1 Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 208-258 of human CDK1 (NP_001777.1). |
Modifications | Unmodified |
Phospho-CDK1-T14 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around T14 of human CDK1 (NP_001777.1). |
Modifications | Phospho T14 |
Phospho-CDK1-Y15 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around Y15 of human CDK1 (NP_001777.1). |
Modifications | Phospho Y15 |
CDK1 Rabbit monoclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |