Products

Jump to Filters
View as table Download
Artemis (DCLRE1C) (N-term) Rabbit Polyclonal Antibody
AP51199PU-N

USD 512.00

2 Weeks

Artemis (DCLRE1C) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 28~58 amino acids from the N-terminal region of Human DCLRE1C.
Artemis (DCLRE1C) Rabbit Polyclonal Antibody
TA339872

USD 375.00

5 Days

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the N terminal of human DCLRE1C. Synthetic peptide located within the following region: SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL
Artemis (DCLRE1C) Rabbit Polyclonal Antibody
TA309620

USD 350.00

5 Days

Rabbit Polyclonal Artemis Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 677-692 [GESIAVKKRKCSLLDT] of the human Artemis protein.
Artemis (DCLRE1C) Rabbit Polyclonal Antibody
TA339873

USD 375.00

5 Days

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the C terminal of human DCLRE1C. Synthetic peptide located within the following region: SQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLLSSQER
DCLRE1C Rabbit Polyclonal Antibody
TA384086

USD 380.00

4 Weeks

Phospho-Artemis (Ser516) Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Artemis around the phosphorylation site of Ser516. AA range:482-531 (Phosphorylated)