Products

View as table Download

DPP6 / Dipeptidylpeptidase 6 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Chimpanzee, Xenopus, Gorilla, Horse, Human, Monkey, Mouse, Rabbit, Rat
Immunogen DPP6 / Dipeptidylpeptidase 6 antibody was raised against synthetic 18 amino acid peptide from extracellular domain of human DPP6. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Horse, Rabbit, Xenopus (100%); Pig, Opossum, Platypus, Lizard (94%); Turkey, Chicken, Zebrafish (89%); Stickleback, Pufferfish (83%).

Rabbit Polyclonal Anti-DPP6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ

DPP6 / Dipeptidylpeptidase 6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Immunogen DPP6 / Dipeptidylpeptidase 6 antibody was raised against synthetic 18 amino acid peptide from near the center of human DPP6. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Gibbon, Monkey (94%); Horse (89%); Panda, Bovine (83%).

Rabbit Polyclonal Anti-DPP6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT

DPP6 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse DPP6

DPP6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DPP6

DPP6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 117-210 of human DPP6 (NP_001277182.1).
Modifications Unmodified