Products

View as table Download

FGB Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FGB

Anti-FGB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 290 amino acids of human fibrinogen beta chain

Rabbit Polyclonal Anti-FGB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FGB antibody is: synthetic peptide directed towards the middle region of Human FGB. Synthetic peptide located within the following region: GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNK

Rabbit polyclonal anti-Fibrinogen beta chain antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FIBB.

Fibrinogen beta chain (FGB) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human FIBB

Fibrinogen beta chain (FGB) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human FIBB

Rabbit Polyclonal Anti-FGB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGB

FGB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGB

Recombinant Anti-Fibrin beta-chain (Clone 8E5)

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.