Germany
Japan
United Kingdom
China
ADRBK2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ADRBK2 |
Products
View as table Download
GRK3 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-GRK3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized peptide derived from internal of human GRK3. |
Rabbit Polyclonal Anti-ADRBK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRBK2 antibody: synthetic peptide directed towards the N terminal of human ADRBK2. Synthetic peptide located within the following region: FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC |
Rabbit Polyclonal Anti-ADRBK2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADRBK2 |
GRK3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GRK3 |
GRK3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human GRK3 |
Active filters
Target Symbol
- GRK3
Antibody Hosts
- Rabbit