Germany
Japan
United Kingdom
China
ADRBK2 (Myc-DDK-tagged)-Human adrenergic, beta, receptor kinase 2 (ADRBK2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ADRBK2 (Myc-DDK tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ADRBK2 (mGFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ADRBK2 (GFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Adrbk2 (Myc-DDK-tagged) - Mouse adrenergic receptor kinase, beta 2 (Adrbk2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN415129 is the updated version of KN215129.
Adrbk2 (GFP-tagged) - Mouse adrenergic receptor kinase beta 2 (Adrbk2) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Adrbk2 (Myc-DDK-tagged) - Mouse adrenergic receptor kinase, beta 2 (Adrbk2), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adrbk2 (Myc-DDK-tagged) - Mouse adrenergic receptor kinase, beta 2 (Adrbk2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Adrbk2 (mGFP-tagged) - Mouse adrenergic receptor kinase, beta 2 (Adrbk2), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adrbk2 (GFP-tagged) - Mouse adrenergic receptor kinase, beta 2 (Adrbk2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Adrbk2 (myc-DDK-tagged) - Mouse adrenergic receptor kinase, beta 2 (Adrbk2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADRBK2 (Myc-DDK tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADRBK2 (mGFP-tagged) - Human adrenergic, beta, receptor kinase 2 (ADRBK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Adrbk2 (Myc-DDK-tagged ORF) - Rat adrenergic, beta, receptor kinase 2 (Adrbk2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Adrbk2 (Myc-DDK-tagged ORF) - Rat adrenergic, beta, receptor kinase 2 (Adrbk2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adrbk2 (Myc-DDK-tagged ORF) - Rat adrenergic, beta, receptor kinase 2 (Adrbk2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Adrbk2 (mGFP-tagged ORF) - Rat adrenergic, beta, receptor kinase 2 (Adrbk2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adrbk2 (GFP-tagged ORF) - Rat adrenergic, beta, receptor kinase 2 (Adrbk2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ADRBK2 (untagged)-Human adrenergic, beta, receptor kinase 2 (ADRBK2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ADRBK2 (untagged)-Kinase deficient mutant (K220M) of Human adrenergic, beta, receptor kinase 2 (ADRBK2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ADRBK2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ADRBK2 |
Lenti ORF clone of Human adrenergic, beta, receptor kinase 2 (ADRBK2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GRK3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
ADRBK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GRK3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ADRBK2 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
GRK3 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-GRK3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized peptide derived from internal of human GRK3. |
Rabbit Polyclonal Anti-ADRBK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRBK2 antibody: synthetic peptide directed towards the N terminal of human ADRBK2. Synthetic peptide located within the following region: FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC |
GRK3 CRISPRa kit - CRISPR gene activation of human G protein-coupled receptor kinase 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Grk3 CRISPRa kit - CRISPR gene activation of mouse G protein-coupled receptor kinase 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene GRK3
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of adrenergic, beta, receptor kinase 2 (ADRBK2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Adrbk2 (untagged) - Mouse adrenergic receptor kinase, beta 2 (Adrbk2), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Adrbk2 (untagged) - Mouse adrenergic receptor kinase, beta 2 (Adrbk2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Grk3
Adrbk2 (untagged ORF) - Rat adrenergic, beta, receptor kinase 2 (Adrbk2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ADRBK2 (untagged)-ORIGENE UNIQUE VARIANT 1 of Human adrenergic, beta, receptor kinase 2 (ADRBK2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Grk3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-ADRBK2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADRBK2 |
GRK3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GRK3 |
GRK3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human GRK3 |
Transient overexpression of GRK3 (NM_005160) in HEK293T cells paraffin embedded controls for ICC/IHC staining
GRK3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Active filters
Target Symbol
- GRK3