Rabbit polyclonal anti-GRK6 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human GRK6. |
Rabbit polyclonal anti-GRK6 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human GRK6. |
Rabbit Polyclonal GRK6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GRK6 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human GRK6. |
Rabbit Polyclonal Anti-GRK6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRK6 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK6. Synthetic peptide located within the following region: LYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLL |
GRK6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human GRK6 (NP_001004106.1). |
Modifications | Unmodified |