Rabbit Polyclonal Anti-Interleukin 4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4 |
Rabbit Polyclonal Anti-Interleukin 4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4 |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
Anti-Human IL-4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-4 |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
Rabbit polyclonal anti-IL4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IL4. |
Rabbit polyclonal IL4 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
Rabbit polyclonal anti-IL-4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human IL-4 |
Anti-Murine IL-4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine IL-4 |
Anti-Rat IL-4 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Rat IL-4 |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Rabbit polyclonal anti-IL-4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Peroxidase Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Biotin Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Biotinylated Anti-Murine IL-4 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine IL-4 |
Biotinylated Anti-Rat IL-4 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Rat IL-4 |
Rabbit Polyclonal Anti-IL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC |
Rabbit Polyclonal Anti-IL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
Rabbit Polyclonal Anti-IL-4 Antibody
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | For immunization recombinant rat IL-4 (E.coli-derived) is used |
Rabbit Polyclonal Anti-IL-4 Antibody, Biotin conjugated
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | For immunization recombinant rat IL-4 (E.coli-derived) is used |
IL4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-153 of human IL4 (NP_000580.1). |
Modifications | Unmodified |
IL-4 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human IL4 |
Recombinant Anti-IL-4 (Clone 11B11)
Applications | ELISA, FC, IHC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
IL-4 Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Produced from sera of rabbits immunized with highly pure Recombinant Murine IL-4. Anti-Murine IL-4-specific antibody was purified by affinity chromatography employing immobilized Murine IL-4 matrix. |
IL-4 Antibody (biotin)
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Biotin |
Immunogen | Produced from sera of rabbits pre-immunized with highly pure recombinant Murine IL-4. Anti-Murine IL-4 specific antibody was purified by affinity chromatography and then biotinylated. |