Products

View as table Download

Rabbit Polyclonal Anti-Interleukin 4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-4

Anti-Murine IL-4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine IL-4

Anti-Rat IL-4 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Rat IL-4

IL4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Biotin Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Biotinylated Anti-Murine IL-4 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine IL-4

Biotinylated Anti-Rat IL-4 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Rat
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Rat IL-4

Rabbit Polyclonal Anti-IL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC

Rabbit Polyclonal Anti-IL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS

Rabbit Polyclonal Anti-IL-4 Antibody

Reactivities Rat
Conjugation Unconjugated
Immunogen For immunization recombinant rat IL-4 (E.coli-derived) is used

Rabbit Polyclonal Anti-IL-4 Antibody, Biotin conjugated

Reactivities Rat
Conjugation Unconjugated
Immunogen For immunization recombinant rat IL-4 (E.coli-derived) is used

IL4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-153 of human IL4 (NP_000580.1).
Modifications Unmodified

IL-4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human IL4

Recombinant Anti-IL-4 (Clone 11B11)

Applications ELISA, FC, IHC
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques.

IL-4 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Produced from sera of rabbits immunized with highly pure Recombinant Murine IL-4. Anti-Murine IL-4-specific antibody was purified by affinity chromatography employing immobilized Murine IL-4 matrix.

IL-4 Antibody (biotin)

Applications ELISA, WB
Reactivities Mouse
Conjugation Biotin
Immunogen Produced from sera of rabbits pre-immunized with highly pure recombinant Murine IL-4. Anti-Murine IL-4 specific antibody was purified by affinity chromatography and then biotinylated.