Products

Jump to Filters
View as table Download
Kv4.2 (KCND2) (N-term) Rabbit Polyclonal Antibody
AP52303PU-N

USD 450.00

2 Weeks

Kv4.2 (KCND2) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 122-151 amino acids from the N-terminal region of human KCND2
Kcnd2 Rabbit Polyclonal Antibody
TA328937

USD 585.00

3 Weeks

Rabbit polyclonal Anti-KV4.2

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)SNQLQSSEDEPAFVSK, corresponding to amino acid residues 454-469 of rat Kv4.2. Intracellular, C-terminus.
Kv4.2 (KCND2) Rabbit Polyclonal Antibody
TA338567

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCND2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCND2 antibody: synthetic peptide directed towards the middle region of human KCND2. Synthetic peptide located within the following region: RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL
Kv4.2 (KCND2) Rabbit Polyclonal Antibody
TA377702

USD 220.00

3 Weeks

KCND2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 501-630 of human KCND2 (NP_036413.1).
Modifications Unmodified