Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-LEG9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEG9 Antibody: A synthesized peptide derived from human LEG9 |
galectin 9 (LGALS9) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 61-90 amino acids from the N-terminal region of Human Galectin-9. |
Rabbit polyclonal anti-Galectin-9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 344 of human Galectin-9 |
Rabbit Polyclonal Anti-LGALS9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LGALS9 antibody is: synthetic peptide directed towards the middle region of Human LGALS9. Synthetic peptide located within the following region: YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV |
Rabbit Polyclonal Anti-LGALS9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGALS9 antibody: synthetic peptide directed towards the middle region of human LGALS9. Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH |
LGALS9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human LGALS9 (NP_002299.2). |
| Modifications | Unmodified |
Recombinant Anti-Galectin 9 (Clone RG9-35)
| Applications | Bl, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- LGALS9
Antibody Hosts
- Rabbit