galectin 9 (LGALS9) Rabbit Polyclonal Antibody

CAT#: TA330879

Rabbit Polyclonal Anti-LGALS9 Antibody

Product Images

Host: Rabbit; Target Name: LGALS9; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LGALS9 antibody is: synthetic peptide directed towards the middle region of Human LGALS9. Synthetic peptide located within the following region: YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: galectin 9
• Database Link:
  NP_002299
  Entrez Gene 3965 Human
  UniProt ID O00182
• Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS9 is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency.
• Synonyms: HUAT; LGALS9A
• Note: Goat: 100%; Human: 100%; Rat: 86%; Dog: 79%; Pig: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%