Rabbit Polyclonal Anti-LMX1B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LMX1B Antibody: A synthesized peptide derived from human LMX1B |
Rabbit Polyclonal Anti-LMX1B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LMX1B Antibody: A synthesized peptide derived from human LMX1B |
Rabbit polyclonal anti-LMX1B antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LMX1B. |
Rabbit Polyclonal LMX1B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal LMX1B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human LMX1B. |
LMX1B rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Rabbit polyclonal anti-LMX1B antibody (CT)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal LMX1B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human LMX1B. |
Rabbit Polyclonal Anti-LMX1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LMX1B Antibody: synthetic peptide directed towards the C terminal of human LMX1B. Synthetic peptide located within the following region: QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS |
LMX1B Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMX1B (NP_001167618.1). |
Modifications | Unmodified |
LMX1B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMX1B (NP_001167618.1). |
Modifications | Unmodified |
LMX1B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 136-395 of human LMX1B (NP_002307.2). |
Modifications | Unmodified |