Germany
Japan
United Kingdom
China
LMX1B (Myc-DDK-tagged)-Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
LMX1B (Myc-DDK-tagged)-Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, LMX1B (mGFP-tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, LMX1B (Myc-DDK tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, LMX1B (mGFP-tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, LMX1B (Myc-DDK tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lmx1b (Myc-DDK-tagged) - Mouse LIM homeobox transcription factor 1 beta (Lmx1b)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lmx1b (GFP-tagged) - Mouse LIM homeobox transcription factor 1 beta (Lmx1b), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LMX1B (GFP-tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LMX1B (Myc-DDK-tagged)-Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, LMX1B (mGFP-tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
LMX1B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410188 is the updated version of KN210188.
Lmx1b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509356 is the updated version of KN309356.
Lenti ORF clone of Lmx1b (Myc-DDK-tagged) - Mouse LIM homeobox transcription factor 1 beta (Lmx1b)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lmx1b (Myc-DDK-tagged) - Mouse LIM homeobox transcription factor 1 beta (Lmx1b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Lmx1b (mGFP-tagged) - Mouse LIM homeobox transcription factor 1 beta (Lmx1b)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lmx1b (GFP-tagged) - Mouse LIM homeobox transcription factor 1 beta (Lmx1b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LMX1B (Myc-DDK tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LMX1B (mGFP-tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LMX1B (Myc-DDK tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LMX1B (mGFP-tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LMX1B (Myc-DDK tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
LMX1B (GFP-tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LMX1B (GFP-tagged) - Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-LMX1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LMX1B Antibody: A synthesized peptide derived from human LMX1B |
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human LIM homeobox transcription factor 1, beta (LMX1B), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-LMX1B antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LMX1B. |
LMX1B rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
LMX1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of LIM homeobox transcription factor 1, beta (LMX1B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qSTAR qPCR primer pairs against Homo sapiens gene LMX1B
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit polyclonal anti-LMX1B antibody (CT)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal LMX1B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human LMX1B. |
Rabbit Polyclonal Anti-LMX1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LMX1B Antibody: synthetic peptide directed towards the C terminal of human LMX1B. Synthetic peptide located within the following region: QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS |
LMX1B - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
LMX1B - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
LMX1B (1-395, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
LMX1B (1-395, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
LMX1B CRISPRa kit - CRISPR gene activation of human LIM homeobox transcription factor 1 beta
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Lmx1b CRISPRa kit - CRISPR gene activation of mouse LIM homeobox transcription factor 1 beta
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
LMX1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Active filters
Target Symbol
- LMX1B