Products

Jump to Filters
View as table Download
NMNAT1 Rabbit Polyclonal Antibody
TA346819

USD 410.00

5 Days

Rabbit Polyclonal Anti-NMNAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NMNAT1 antibody: synthetic peptide directed towards the N terminal of human NMNAT1. Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL
NMNAT1 Rabbit Polyclonal Antibody
TA379181

USD 220.00

3 Weeks

NMNAT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NMNAT1 (NP_073624.2).
Modifications Unmodified