Germany
Japan
United Kingdom
China
NMNAT1 (Myc-DDK-tagged)-Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Nmnat1 (Myc-DDK-tagged) - Mouse nicotinamide nucleotide adenylyltransferase 1 (Nmnat1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, NMNAT1 (Myc-DDK tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NMNAT1 (mGFP-tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NMNAT1 (GFP-tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Nmnat1 (GFP-tagged) - Mouse nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NMNAT1 (myc-DDK-tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NMNAT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404825 is the updated version of KN204825.
Nmnat1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN511074 is the updated version of KN311074.
Lenti ORF clone of Nmnat1 (Myc-DDK-tagged) - Mouse nicotinamide nucleotide adenylyltransferase 1 (Nmnat1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nmnat1 (Myc-DDK-tagged) - Mouse nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nmnat1 (mGFP-tagged) - Mouse nicotinamide nucleotide adenylyltransferase 1 (Nmnat1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nmnat1 (GFP-tagged) - Mouse nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NMNAT1 (Myc-DDK tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NMNAT1 (mGFP-tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NMNAT1 (myc-DDK-tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Nmnat1 (Myc-DDK-tagged ORF) - Rat nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Nmnat1 (Myc-DDK-tagged ORF) - Rat nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nmnat1 (Myc-DDK-tagged ORF) - Rat nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nmnat1 (mGFP-tagged ORF) - Rat nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nmnat1 (GFP-tagged ORF) - Rat nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NMNAT1 (untagged)-Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-NMNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NMNAT1 antibody: synthetic peptide directed towards the N terminal of human NMNAT1. Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL |
Nmnat1 (untagged) - Mouse nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Nmnat1 (untagged ORF) - Rat nicotinamide nucleotide adenylyltransferase 1 (Nmnat1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
NMNAT1 (untagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
NMNAT1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
NMNAT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 1 (NMNAT1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qSTAR qPCR primer pairs against Mus musculus gene Nmnat1
Nmnat1 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
NMNAT1 (1-279, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
NMNAT1 (1-279, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
NMNAT1 CRISPRa kit - CRISPR gene activation of human nicotinamide nucleotide adenylyltransferase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Nmnat1 CRISPRa kit - CRISPR gene activation of mouse nicotinamide nucleotide adenylyltransferase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene NMNAT1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene NMNAT1
NMNAT1 MS Standard C13 and N15-labeled recombinant protein (NP_073624)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
NMNAT1 (GFP-tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NMNAT1 (GFP-tagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NMNAT1 (untagged) - Human nicotinamide nucleotide adenylyltransferase 1 (NMNAT1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- NMNAT1