Products

View as table Download

Rabbit Polyclonal Anti-RAD51 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS

RAD51 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

RAD51 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

RAD51 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human RAD51A

Rabbit polyclonal RAD51 (Ab-315) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human RAD51 around the phosphorylation site of tyrosine 315 (K-I-YP-D-S).

Rabbit polyclonal RAD51 (Tyr315) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RAD51 around the phosphorylation site of tyrosine 315 (K-I-YP-D-S).
Modifications Phospho-specific

Anti-RAD51 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 301-312 amino acids of Human RAD51 homolog (S. cerevisiae)

Rabbit Polyclonal Anti-RAD51 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAD51

RAD51 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD51

RAD51 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD51

RAD51 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD51

RAD51 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human RAD51

RAD51 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human RAD51

RAD51 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAD51

Rad51 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Rad51 (NP_002866.2).
Modifications Unmodified

Rad51 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Rad51

Rad51 Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-RAD51 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAD51

Rabbit Polyclonal anti-RAD51 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAD51