Products

View as table Download

Rabbit Polyclonal Anti-RIOK2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RIOK2 antibody: synthetic peptide directed towards the middle region of human RIOK2. Synthetic peptide located within the following region: IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD

Rabbit Polyclonal Anti-RIOK2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RIOK2 antibody: synthetic peptide directed towards the N terminal of human RIOK2. Synthetic peptide located within the following region: SDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRL

RIOK2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 253-552 of human RIOK2 (NP_060813.2).
Modifications Unmodified