Products

cDNA Clones (37)
Antibodies (23)
Gene Expression (16)
RNAi (13)
Proteins (9)
Jump to Filters
View as table Download
RIOK2 (NM_018343) Human Tagged ORF Clone
RC201484

USD 420.00

In Stock

RIOK2 (Myc-DDK-tagged)-Human RIO kinase 2 (RIOK2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RIOK2 (NM_018343) Human Tagged ORF Clone Lentiviral Particle
RC201484L1V

USD 820.00

3 Weeks

Lenti ORF particles, RIOK2 (Myc-DDK tagged) - Human RIO kinase 2 (RIOK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
RIOK2 (NM_018343) Human Tagged ORF Clone Lentiviral Particle
RC201484L2V

USD 820.00

6 Weeks

Lenti ORF particles, RIOK2 (mGFP-tagged) - Human RIO kinase 2 (RIOK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Riok2 (NM_025934) Mouse Tagged ORF Clone
MR208712

USD 500.00

In Stock

Riok2 (Myc-DDK-tagged) - Mouse RIO kinase 2 (yeast) (Riok2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RIOK2 (NM_001159749) Human Tagged ORF Clone
RC228393

USD 440.00

In Stock

RIOK2 (Myc-DDK-tagged)-Human RIO kinase 2 (yeast) (RIOK2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RIOK2 (NM_018343) Human Tagged ORF Clone
RG201484

USD 460.00

In Stock

RIOK2 (GFP-tagged) - Human RIO kinase 2 (RIOK2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RIOK2 Human Gene Knockout Kit (CRISPR)
KN401484

USD 1,290.00

2 Weeks

RIOK2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN401484 is the updated version of KN201484.
Riok2 Mouse Gene Knockout Kit (CRISPR)
KN514838

USD 1,290.00

2 Weeks

Riok2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514838 is the updated version of KN314838.
Riok2 (NM_025934) Mouse Tagged ORF Clone
MG208712

USD 550.00

3 Weeks

Riok2 (GFP-tagged) - Mouse RIO kinase 2 (yeast) (Riok2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Riok2 (NM_025934) Mouse Tagged ORF Clone
MR208712L3

USD 700.00

3 Weeks

Lenti ORF clone of Riok2 (Myc-DDK-tagged) - Mouse RIO kinase 2 (yeast) (Riok2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RIOK2 (NM_018343) Human Tagged ORF Clone
RC201484L3

USD 620.00

3 Weeks

Lenti ORF clone of Human RIO kinase 2 (RIOK2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RIOK2 (NM_018343) Human Tagged ORF Clone Lentiviral Particle
RC201484L3V

USD 820.00

5 Weeks

Lenti ORF particles,-áRIOK2-á(Myc-DDK tagged) - Human RIO kinase 2 (RIOK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RIOK2 (NM_018343) Human Tagged ORF Clone Lentiviral Particle
RC201484L4V

USD 820.00

3 Weeks

Lenti ORF particles,-áRIOK2-á(mGFP-tagged) - Human RIO kinase 2 (RIOK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RIOK2 (NM_001159749) Human Tagged ORF Clone
RC228393L3

USD 640.00

3 Weeks

Lenti-ORF clone of RIOK2 (Myc-DDK-tagged)-Human RIO kinase 2 (yeast) (RIOK2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RIOK2 (NM_001159749) Human Tagged ORF Clone Lentiviral Particle
RC228393L4V

USD 840.00

3 Weeks

Lenti ORF particles, RIOK2 (mGFP-tagged)-Human RIO kinase 2 (yeast) (RIOK2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RIOK2 (NM_001159749) Human Tagged ORF Clone
RG228393

USD 480.00

3 Weeks

RIOK2 (GFP-tagged) - Human RIO kinase 2 (yeast) (RIOK2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Riok2 (NM_001009687) Rat Tagged ORF Clone
RR205029

USD 740.00

5 Weeks

Riok2 (Myc-DDK-tagged ORF) - Rat RIO kinase 2 (yeast) (Riok2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Riok2 (NM_001009687) Rat Tagged ORF Clone
RR205029L3

USD 940.00

8 Weeks

Lenti ORF clone of Riok2 (Myc-DDK-tagged ORF) - Rat RIO kinase 2 (yeast) (Riok2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Riok2 (NM_001009687) Rat Tagged ORF Clone
RR205029L4

USD 1,040.00

8 Weeks

Lenti ORF clone of Riok2 (mGFP-tagged ORF) - Rat RIO kinase 2 (yeast) (Riok2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RIOK2 (NM_018343) Human Recombinant Protein
TP760270

USD 215.00

In Stock

Recombinant protein of human RIO kinase 2 (RIOK2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
RIOK2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E11]
TA505140BM

USD 420.00

In Stock

RIOK2 mouse monoclonal antibody,clone 3E11, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation HRP
Riok2 (NM_025934) Mouse Tagged Lenti ORF Clone
MR208712L1

USD 864.00

In Stock

Lenti ORF clone of Riok2 (Myc-DDK-tagged) - Mouse RIO kinase 2 (yeast) (Riok2)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RIOK2 Rabbit Polyclonal Antibody
TA344875

USD 475.00

5 Days

Rabbit Polyclonal Anti-RIOK2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RIOK2 antibody: synthetic peptide directed towards the middle region of human RIOK2. Synthetic peptide located within the following region: IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD
RIOK2 (NM_018343) Human Tagged ORF Clone
RC201484L1

USD 768.00

In Stock

Lenti ORF clone of Human RIO kinase 2 (RIOK2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RIOK2 (NM_018343) Human Untagged Clone
SC113560

USD 310.00

In Stock

RIOK2 (untagged)-Human RIO kinase 2 (RIOK2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RIOK2 Rabbit Polyclonal Antibody
TA344876

USD 475.00

5 Days

Rabbit Polyclonal Anti-RIOK2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RIOK2 antibody: synthetic peptide directed towards the N terminal of human RIOK2. Synthetic peptide located within the following region: SDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRL
RIOK2 (NM_018343) Human Untagged Clone
SC323501

USD 760.00

In Stock

RIOK2 (untagged)-Kinase deficient mutant (D228A) of Human RIO kinase 2 (yeast) (RIOK2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Riok2 (NM_025934) Mouse Tagged ORF Clone
MR208712L2

USD 700.00

3 Weeks

Lenti ORF clone of Riok2 (mGFP-tagged) - Mouse RIO kinase 2 (yeast) (Riok2)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RIOK2 (NM_018343) Human Tagged ORF Clone
RC201484L2

USD 620.00

3 Weeks

Lenti ORF clone of Human RIO kinase 2 (RIOK2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RIOK2 Human siRNA Oligo Duplex (Locus ID 55781)
SR310938

USD 430.00

In Stock

RIOK2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

RIOK2 (NM_018343) Human Over-expression Lysate
LC402668

USD 121.00

In Stock

RIOK2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Riok2 (NM_025934) Mouse Untagged Clone
MC203807

USD 210.00

In Stock

Riok2 (untagged) - Mouse RIO kinase 2 (yeast) (Riok2), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
RIOK2 Human shRNA Plasmid Kit (Locus ID 55781)
TF320713

USD 715.00

In Stock

RIOK2 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector

Format Retroviral plasmids
Vector pRFP-C-RS
RIOK2 Human Gene Knockout Kit (CRISPR)
KN201484

USD 1,290.00

4 Weeks

RIOK2 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
Riok2 Mouse Gene Knockout Kit (CRISPR)
KN314838

USD 1,290.00

2 Weeks

Riok2 - mouse gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
Riok2 Mouse qPCR Primer Pair (NM_025934)
MP214826

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Riok2

RIOK2 Mouse Monoclonal Antibody [Clone ID: OTI2F4]
CF505085

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications WB
Reactivities Human
Conjugation Unconjugated
RIOK2 Mouse Monoclonal Antibody [Clone ID: OTI3F6]
CF505135

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications WB
Reactivities Human
Conjugation Unconjugated
RIOK2 Mouse Monoclonal Antibody [Clone ID: OTI3E11]
CF505140

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RIOK2 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated