Products

View as table Download

Rabbit Polyclonal Anti-SEPHS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEPHS1 antibody: synthetic peptide directed towards the C terminal of human SEPHS1. Synthetic peptide located within the following region: PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

Rabbit polyclonal antibody to Selenophosphate synthetase 1 (selenophosphate synthetase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 204 of Selenophosphate synthetase 1 (Uniprot ID#P49903)

Rabbit polyclonal Selenophosphate Synthetase 1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a full-length recombinant protein corresponding to mouse SPS1.

SEPHS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SEPHS1

SEPHS1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SEPHS1

SEPHS1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SEPHS1

SEPHS1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-392 of human SEPHS1 (NP_036379.2).
Modifications Unmodified

SEPHS1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-392 of human SEPHS1 (NP_036379.2).
Modifications Unmodified