Products

Jump to Filters
View as table Download
SFMBT1 Rabbit Polyclonal Antibody
TA308167

USD 415.00

5 Days

Rabbit polyclonal antibody to SFMBT1 (Scm-like with four mbt domains 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 13 and 225 of SFMBT1 (Uniprot ID#Q9UHJ3)
SFMBT1 Rabbit Polyclonal Antibody
TA339649

USD 375.00

5 Days

Rabbit Polyclonal Anti-SFMBT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SFMBT1 antibody is: synthetic peptide directed towards the middle region of Human SFMBT1. Synthetic peptide located within the following region: PGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKG
SFMBT1 Rabbit Polyclonal Antibody
TA359520

USD 360.00

5 Days

SFMBT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SFMBT1
SFMBT1 Rabbit Monoclonal Antibody [Clone ID: RAB-C396]
TA386473

USD 523.00

2 Weeks

Recombinant Anti-SFMBT1 (Clone RAB-C396)

Applications ChIP, ELISA
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques.