Rabbit anti-SMAD5 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human SMAD5 |
Rabbit anti-SMAD5 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human SMAD5 |
Rabbit Polyclonal Anti-SMAD5 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMAD5 antibody: synthetic peptide directed towards the middle region of human SMAD5. Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD |
Rabbit Polyclonal Anti-SMAD5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMAD5 antibody: synthetic peptide directed towards the middle region of human SMAD5. Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD |
Anti-SMAD5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5 |
Anti-SMAD5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5 |
SMAD5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human SMAD5 |
Smad5 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 140-240 of human Smad5 (NP_005894.3). |
Modifications | Unmodified |
Smad5 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 186-465 of human Smad5 (NP_001001420.1). |
Modifications | Unmodified |
Smad5 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Smad5 |
Smad5 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |