Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TAZ (tafazzin) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TAZ. |
Products
View as table Download
Rabbit Polyclonal Anti-TAZ Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAZ antibody is: synthetic peptide directed towards the C-terminal region of TAZ. Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ |
TAZ (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TAZ |
TAZ Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TAZ |
Tafazzin / TAZ Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 174-248 of human Tafazzin / TAZ (NP_851830.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TAZ
Antibody Hosts
- Rabbit