Germany
Japan
United Kingdom
China
Rabbit Polyclonal TGIF Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Products
View as table Download
TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 152-182 amino acids from the Central region of human TGIF1 |
Rabbit Polyclonal Anti-TGIF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGIF1 antibody: synthetic peptide directed towards the C terminal of human TGIF1. Synthetic peptide located within the following region: GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN |
TGIF1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 123-272 of human TGIF1 (NP_003235.1). |
Active filters
Target Symbol
- TGIF1
Antibody Hosts
- Rabbit