Products

View as table Download

Rabbit Polyclonal TGIF Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 215-245 amino acids from the Central region of human TGIF1

TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 152-182 amino acids from the Central region of human TGIF1

Rabbit Polyclonal Anti-TGIF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TGIF1 antibody: synthetic peptide directed towards the C terminal of human TGIF1. Synthetic peptide located within the following region: GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN

TGIF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 123-272 of human TGIF1 (NP_003235.1).