Products

Jump to Filters
View as table Download
UGT1A7 Rabbit Polyclonal Antibody
TA331082

USD 375.00

5 Days

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN