Products

cDNA Clones (8)
RNAi (4)
Gene Expression (3)
Proteins (3)
Antibodies (1)
Jump to Filters
View as table Download
UGT1A7 (NM_019077) Human Tagged ORF Clone
RC216210

USD 480.00

In Stock

UGT1A7 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT1A7 Human Gene Knockout Kit (CRISPR)
KN416210

USD 1,290.00

2 Weeks

UGT1A7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN416210 is the updated version of KN216210.
UGT1A7 (NM_019077) Human Tagged ORF Clone
RC216210L3

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone Lentiviral Particle
RC216210L3V

USD 880.00

6 Weeks

Lenti ORF particles, UGT1A7 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone
RC216210L4

USD 680.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone Lentiviral Particle
RC216210L4V

USD 880.00

6 Weeks

Lenti ORF particles, UGT1A7 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT1A7 (NM_019077) Human Tagged ORF Clone
RG216210

USD 530.00

3 Weeks

UGT1A7 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT1A7 (NM_019077) Human Untagged Clone
SC304666

USD 900.00

In Stock

UGT1A7 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
UGT1A7 Rabbit Polyclonal Antibody
TA331082

USD 375.00

5 Days

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
Human UGT1A7 activation kit by CRISPRa
GA110186

USD 1,290.00

2 Weeks

UGT1A7 CRISPRa kit - CRISPR gene activation of human UDP glucuronosyltransferase family 1 member A7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
UGT1A7 Human qPCR Primer Pair (NM_019077)
HP213396

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene UGT1A7

UGT1A7 (NM_019077) Human 3' UTR Clone
SC209429

USD 560.00

4 Weeks

3`UTR clone of UDP glucuronosyltransferase 1 family polypeptide A7 (UGT1A7) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
UGT1A7 Human siRNA Oligo Duplex (Locus ID 54577)
SR310160

USD 430.00

2 Weeks

UGT1A7 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

UGT1A7 (NM_019077) ICC Control Block
TB416210

USD 1,130.00

4 Weeks

Transient overexpression of UGT1A7 (NM_019077) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT1A7 Human shRNA Plasmid Kit (Locus ID 54577)
TL300664

USD 815.00

2 Weeks

UGT1A7 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
UGT1A7 Human shRNA Lentiviral Particle (Locus ID 54577)
TL300664V

USD 1,395.00

5 Weeks

UGT1A7 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
UGT1A7 Human shRNA Plasmid Kit (Locus ID 54577)
TR300664

USD 715.00

2 Weeks

UGT1A7 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
UGT1A7 Cytosection
TS416210

USD 225.00

4 Weeks

Transient overexpression of UGT1A7 (NM_019077) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGT1A7 Cytosection
TS416210P5

USD 889.00

4 Weeks

Transient overexpression of UGT1A7 (NM_019077) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack