Rabbit Polyclonal Anti-YARS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH |
Rabbit Polyclonal Anti-Yars2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Yars2 Antibody is: synthetic peptide directed towards the middle region of Rat Yars2. Synthetic peptide located within the following region: NVIALVGGSTALLGDPSGRTKEREALSAECVRANARALQRGLETLAANHA |
YARS2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 228-477 of human YARS2 (NP_001035526.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
