Products

View as table Download

CXCR4 Mouse Monoclonal Antibody, clone 772AA17

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772AA80

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772AA101

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772X122

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal Anti-PRKCG Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG