Products

Jump to Filters
View as table Download
Cyclin D1 (CCND1) Mouse Monoclonal Antibody [Clone ID: CD1.1]
AM20988PU-N

USD 440.00

2 Weeks

Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1

Applications ELISA, FC, IF, IHC, IP, WB
Reactivities Human, Rat
Caspase 9 (CASP9) (299-318) Rabbit Polyclonal Antibody
AP22914PU-N

USD 440.00

2 Weeks

Caspase 9 (CASP9) (299-318) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Akirin1 antibody was raised against peptide corresponding to aa 299-318 of the human Caspase 9.
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 375.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 375.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA321153

USD 345.00

In Stock

Anti-TP53 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA321307

USD 345.00

In Stock

Anti-CASP9 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9