Products

View as table Download

Glutathione Peroxidase 4 (184-196) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEPLVIEKDLPHY, from the C-Terminus of protein sequence according to NP_002076.2NP_001034937.1.

Rabbit Polyclonal Anti-GPX4 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA

Goat Polyclonal Antibody against GPX4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEPLVIEKDLPHY, from the C Terminus of the protein sequence according to NP_002076.2; NP_001034937.1.

GPX4 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-197 of human GPX4 (NP_002076.2).
Modifications Unmodified