TCF7 (617-631) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Canine, Equine, Hamster, Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide from positions 617-631 of human TCF1 (NP_000536.5) |
TCF7 (617-631) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bat, Canine, Equine, Hamster, Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide from positions 617-631 of human TCF1 (NP_000536.5) |
Rabbit Polyclonal Anti-TCF7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM |
TCF7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TCF7 |