Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal anti-RPL22 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL22. |
Rabbit polyclonal Anti-RPL18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL18 antibody: synthetic peptide directed towards the N terminal of human RPL18. Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR |
Rabbit polyclonal anti-RPL37 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPL37. |
Rabbit polyclonal S6 Ribosomal Protein antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human S6 Ribosomal Protein. |
Rabbit polyclonal anti-RPS21 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS21. |
Rabbit polyclonal anti-RPS25 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS25. |
Anti-RPLP0 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-RPL15 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-RPL26L1 Antibody
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL26L1 |
Rabbit Polyclonal Anti-RPL11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL11 |
Rabbit Polyclonal Anti-RPLP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPLP2 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Applications
- IHC
Pathways
- Ribosome
Filter by
Category
Target Symbol
- RPL10 (10)
- RPL10A (10)
- RPL7A (10)
- RPSA (8)
- UBA52 (7)
- RPS6 (6)
- RPL27 (5)
- RPS3 (4)
- RPL15 (3)
- RPL8 (3)
- RPLP0 (3)
- FAU (2)
- RPL17 (2)
- RPL22 (2)
- RPL5 (2)
- RPLP2 (2)
- MRPL13 (1)
- RPL11 (1)
- RPL13 (1)
- RPL13A (1)
- RPL18 (1)
- RPL18A (1)
- RPL23 (1)
- RPL26L1 (1)
- RPL27A (1)
- RPL3 (1)
- RPL30 (1)
- RPL31 (1)
- RPL35 (1)
- RPL36 (1)
- RPL37 (1)
- RPL3L (1)
- RPLP1 (1)
- RPS10 (1)
- RPS13 (1)
- RPS15 (1)
- RPS16 (1)
- RPS18 (1)
- RPS19 (1)
- RPS2 (1)
- RPS20 (1)
- RPS21 (1)
- RPS25 (1)
- RPS27 (1)
- RPS27A (1)
- RPS28 (1)
- RPS29 (1)
- RPS3A (1)
- RPS4Y1 (1)
- RPS7 (1)
- RPS9 (1)