Products

View as table Download

TCF7 (617-631) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Canine, Equine, Hamster, Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide from positions 617-631 of human TCF1 (NP_000536.5)

Rabbit Polyclonal Anti-TCF7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM