Products

View as table Download

Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201)

Rabbit polyclonal anti-B4GALT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.

FUT8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 329-357 amino acids from the Central region of Human Fucosyltransferase 8

CHST6 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 303-333 amino acids from the C-terminal region of human CHST6

Rabbit Polyclonal antibody to ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 68 and 327 of ST3GAL2 (Uniprot ID#Q16842)

Rabbit Polyclonal Anti-CHST1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST1 antibody: synthetic peptide directed towards the N terminal of human CHST1. Synthetic peptide located within the following region: SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL

Rabbit Polyclonal Anti-CHST4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST4 antibody: synthetic peptide directed towards the middle region of human CHST4. Synthetic peptide located within the following region: CSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVR

Carrier-free (BSA/glycerol-free) B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) B4GALT4 mouse monoclonal antibody, clone OTI8B6 (formerly 8B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-FUT8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT8

B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

B4GALT4 mouse monoclonal antibody, clone OTI8B6 (formerly 8B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

B4GALT4 mouse monoclonal antibody, clone OTI8B6 (formerly 8B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated