Carbohydrate sulfotransferase 1 (CHST1) Rabbit Polyclonal Antibody

CAT#: TA338221

Rabbit Polyclonal Anti-CHST1 Antibody

Product Images

WB Suggested Anti-CHST1 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHST1 antibody: synthetic peptide directed towards the N terminal of human CHST1. Synthetic peptide located within the following region: SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: carbohydrate sulfotransferase 1
• Database Link:
  NP_003645
  Entrez Gene 8534 Human
  UniProt ID O43916
• Background: This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011]
• Synonyms: C6ST; GST-1; KS6ST; KSGal6ST; KSST
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Keratan sulfate biosynthesis, Metabolic pathways