Products

View as table Download

Rabbit Polyclonal Anti-AADAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the N terminal of human AADAT. Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

KATII / AADAT Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from N-terminus of human AADAT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Elephant (100%); Monkey, Rabbit (94%); Marmoset, Dog (82%).

KATII / AADAT Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Immunogen KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from internal region of human AADAT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey (88%); Dog, Elephant (82%).

KATII / AADAT Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human
Immunogen KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from internal region of human AADAT. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset (88%); Panda, Pig (82%).

Anti-AASDHPPT Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-AASDHPPT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein