Products

cDNA Clones (61)
Proteins (45)
Antibodies (16)
Jump to Filters
View as table Download
AASDHPPT (NM_015423) Human Tagged ORF Clone
RC205091

USD 420.00

In Stock

AASDHPPT (Myc-DDK-tagged)-Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AASDH (NM_181806) Human Tagged ORF Clone
RC216923

USD 1,150.00

In Stock

AASDH (Myc-DDK-tagged)-Human aminoadipate-semialdehyde dehydrogenase (AASDH)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AASDHPPT (NM_015423) Human Recombinant Protein
TP305091

USD 823.00

In Stock

Recombinant protein of human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)

Tag C-Myc/DDK
Expression Host HEK293T
AASS (NM_005763) Human Tagged ORF Clone
RC224831

USD 1,030.00

In Stock

AASS (Myc-DDK-tagged)-Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDHPPT (NM_015423) Human Tagged ORF Clone
RC205091L3

USD 620.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDHPPT (NM_015423) Human Tagged ORF Clone Lentiviral Particle
RC205091L3V

USD 820.00

6 Weeks

Lenti ORF particles, AASDHPPT (Myc-DDK tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDHPPT (NM_015423) Human Tagged ORF Clone
RC205091L4

USD 620.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDHPPT (NM_015423) Human Tagged ORF Clone Lentiviral Particle
RC205091L4V

USD 820.00

6 Weeks

Lenti ORF particles, AASDHPPT (mGFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_181806) Human Tagged ORF Clone
RC216923L3

USD 1,350.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase (AASDH), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_181806) Human Tagged ORF Clone Lentiviral Particle
RC216923L3V

USD 1,550.00

6 Weeks

Lenti ORF particles, AASDH (Myc-DDK tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_181806) Human Tagged ORF Clone
RC216923L4

USD 1,350.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase (AASDH), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_181806) Human Tagged ORF Clone Lentiviral Particle
RC216923L4V

USD 1,550.00

6 Weeks

Lenti ORF particles, AASDH (mGFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aminoadipate aminotransferase (AADAT) (NM_182662) Human Tagged ORF Clone Lentiviral Particle
RC222252L3V

USD 820.00

6 Weeks

Lenti ORF particles, AADAT (Myc-DDK tagged) - Human aminoadipate aminotransferase (AADAT), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aminoadipate aminotransferase (AADAT) (NM_182662) Human Tagged ORF Clone Lentiviral Particle
RC222252L4V

USD 820.00

6 Weeks

Lenti ORF particles, AADAT (mGFP-tagged) - Human aminoadipate aminotransferase (AADAT), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aminoadipate aminotransferase (AADAT) (NM_016228) Human Tagged ORF Clone Lentiviral Particle
RC223277L3V

USD 820.00

5 Weeks

Lenti ORF particles, AADAT (Myc-DDK tagged) - Human aminoadipate aminotransferase (AADAT), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aminoadipate aminotransferase (AADAT) (NM_016228) Human Tagged ORF Clone Lentiviral Particle
RC223277L4V

USD 820.00

7 Weeks

Lenti ORF particles, AADAT (mGFP-tagged) - Human aminoadipate aminotransferase (AADAT), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASS (NM_005763) Human Tagged ORF Clone
RC224831L3

USD 1,230.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASS (NM_005763) Human Tagged ORF Clone Lentiviral Particle
RC224831L3V

USD 1,430.00

6 Weeks

Lenti ORF particles, AASS (Myc-DDK tagged) - Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AASS (NM_005763) Human Tagged ORF Clone
RC224831L4

USD 1,230.00

3 Weeks

Lenti ORF clone of Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASS (NM_005763) Human Tagged ORF Clone Lentiviral Particle
RC224831L4V

USD 1,430.00

6 Weeks

Lenti ORF particles, AASS (mGFP-tagged) - Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AASDH (NM_001286670) Human Tagged ORF Clone
RC239089

USD 480.00

3 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286672) Human Tagged ORF Clone
RC239665

USD 750.00

4 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286671) Human Tagged ORF Clone
RC239693

USD 750.00

4 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286669) Human Tagged ORF Clone
RC239811

USD 750.00

4 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_001286668) Human Tagged ORF Clone
RC239866

USD 750.00

4 Weeks

AASDH (myc-DDK-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDHPPT (NM_015423) Human Tagged ORF Clone
RG205091

USD 460.00

3 Weeks

AASDHPPT (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASDH (NM_181806) Human Tagged ORF Clone
RG216923

USD 1,260.00

3 Weeks

AASDH (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase (AASDH)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AASS (NM_005763) Human Tagged ORF Clone
RG224831

USD 1,130.00

3 Weeks

AASS (GFP-tagged) - Human aminoadipate-semialdehyde synthase (AASS), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aminoadipate aminotransferase (AADAT) (NM_016228) Human Over-expression Lysate
LY414111

USD 396.00

In Stock

Transient overexpression lysate of aminoadipate aminotransferase (AADAT), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Aminoadipate aminotransferase (AADAT) Rabbit Polyclonal Antibody
TA331923

USD 310.00

5 Days

Rabbit Polyclonal Anti-AADAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the N terminal of human AADAT. Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI
Aminoadipate aminotransferase (AADAT) Rabbit Polyclonal Antibody
TA310138

USD 205.00

2 Weeks

Rabbit anti-AADAT polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human AADAT.
AASS Rabbit Polyclonal Antibody
TA315023

USD 345.00

In Stock

Rabbit polyclonal anti-AASS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human AASS.
AASDHPPT Rabbit Polyclonal Antibody
TA346776

USD 475.00

5 Days

Rabbit Polyclonal Anti-AASDHPPT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AASDHPPT antibody: synthetic peptide directed towards the C terminal of human AASDHPPT. Synthetic peptide located within the following region: SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE
AASDHPPT Rabbit Polyclonal Antibody
TA315703

USD 345.00

In Stock

Rabbit polyclonal anti-AASDHPPT antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AASDHPPT.