AASDHPPT Rabbit Polyclonal Antibody

CAT#: TA346776

Rabbit Polyclonal Anti-AASDHPPT Antibody

Product Images

WB Suggested Anti-AASDHPPT Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AASDHPPT antibody: synthetic peptide directed towards the C terminal of human AASDHPPT. Synthetic peptide located within the following region: SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
• Database Link:
  NP_056238
  Entrez Gene 60496 Human
  UniProt ID Q9NRN7
• Background: The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008]
• Synonyms: AASD-PPT; CGI-80; LYS2; LYS5
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Rat: 92%; Dog: 86%; Rabbit: 86%; Guinea pig: 85%; Bovine: 79%

Reference Data

• Protein Pathways: Lysine biosynthesis, Lysine degradation, Metabolic pathways