Products

View as table Download

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2

ALDH3A2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALDH3A2

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Biotin

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation HRP

ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated