Products

View as table Download

Rabbit Polyclonal Anti-GNRH1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNRH1

GnRH (GNRH1) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated

GNRH1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS

GNRH1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNRH1