Products

View as table Download

GPC3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC3

Rabbit polyclonal Anti-GPC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3. Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Mouse Monoclonal Glypican 3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

GPC3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC3