Products

View as table Download

Rabbit Polyclonal Anti-IMPDH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE

Rabbit Polyclonal Anti-IMPDH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IMPDH1

IMPDH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IMPDH1