PML Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PML |
PML Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PML |
Rabbit polyclonal anti-PML antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PML. |
Rabbit Polyclonal Anti-PML Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PML Antibody: synthetic peptide directed towards the C terminal of human PML. Synthetic peptide located within the following region: EGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFR |