PML Protein (PML) Rabbit Polyclonal Antibody

CAT#: TA331681

Rabbit Polyclonal Anti-PML Antibody

Product Images

WB Suggested Anti-PML Antibody Titration: 1 ug/ml; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: PML; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

• 

  Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-PML antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PML Antibody: synthetic peptide directed towards the C terminal of human PML. Synthetic peptide located within the following region: EGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: promyelocytic leukemia
• Database Link:
  NP_150242
  Entrez Gene 5371 Human
  UniProt ID P29590
• Background: PML is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. PML localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus.
• Synonyms: MYL; PP8675; RNF71; TRIM19
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Rabbit: 92%; Horse: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis