Products

View as table Download

Rabbit polyclonal anti-RORA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human RORA.

ROR alpha (RORA) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA