Products

View as table Download

Rabbit Polyclonal Anti-SUV39H1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUV39H1 antibody: synthetic peptide directed towards the C terminal of human SUV39H1. Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF

SUV39H1 Rabbit polyclonal Antibody

Applications ChIP, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SUV39H1 (NP_003164.1).
Modifications Unmodified