Germany
Japan
United Kingdom
China
SUV39H1 (Myc-DDK-tagged)-Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
SUV39H1 (GFP-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Suv39h1 (Myc-DDK-tagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SUV39H1 (untagged)-Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Suv39h1 (GFP-tagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, SUV39H1 (Myc-DDK tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SUV39H1 (mGFP-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SUV39H1 (myc-DDK-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SUV39H1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402428 is the updated version of KN202428.
Suv39h1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517005 is the updated version of KN317005.
Lenti ORF particles, Suv39h1 (Myc-DDK-tagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Suv39h1 (mGFP-tagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Suv39h1 (GFP-tagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Suv39h1 (myc-DDK-tagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SUV39H1 (Myc-DDK tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, SUV39H1 (mGFP-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Suv39h1 (Myc-DDK-tagged ORF) - Rat suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Suv39h1 (Myc-DDK-tagged ORF) - Rat suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Suv39h1 (Myc-DDK-tagged ORF) - Rat suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Suv39h1 (mGFP-tagged ORF) - Rat suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Suv39h1 (GFP-tagged ORF) - Rat suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Suv39h1 (Myc-DDK-tagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
SUV39H1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
SUV39H1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Suv39h1 (untagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-SUV39H1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUV39H1 antibody: synthetic peptide directed towards the C terminal of human SUV39H1. Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF |
Lenti ORF clone of Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SUV39H1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Suv39h1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
SUV39H1 (N-term) mouse monoclonal antibody, clone 42AT239.96.72, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
SUV39H1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
3`UTR clone of suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit Polyclonal Anti-SUV39H1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUV39H1 antibody: synthetic peptide directed towards the N terminal of human SUV39H1. Synthetic peptide located within the following region: RHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPP |
Suv39h1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
SUV39H1 CRISPRa kit - CRISPR gene activation of human suppressor of variegation 3-9 homolog 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Suv39h1 CRISPRa kit - CRISPR gene activation of mouse suppressor of variegation 3-9 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SUV39H1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene SUV39H1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene SUV39H1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
SUV39H1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
SUV39H1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
SUV39H1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Suv39h1 (untagged) - Mouse suppressor of variegation 3-9 homolog 1 (Drosophila) (Suv39h1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Suv39h1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Suv39h1
SUV39H1 (GFP-tagged) - Human suppressor of variegation 3-9 homolog 1 (Drosophila) (SUV39H1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Active filters
Target Symbol
- SUV39H1